![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thhalv10019132m | ||||||||
Common Name | EUTSA_v10019132mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 213aa MW: 23977.8 Da PI: 8.4462 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.3 | 1.5e-26 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdaev v+ifs++gkl+e Thhalv10019132m 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEVGVVIFSPQGKLFEL 57 79********************************************996 PP | |||||||
2 | K-box | 61.3 | 3.8e-21 | 99 | 181 | 18 | 100 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + e++ Lk+ei++Lq+ +R + G + + ++l+eL Le++Le +++iRs K+e++l++i+ l++ke l+++nk+L k+ee Thhalv10019132m 99 KDEVNVLKQEIDMLQKGIRYMFGGGEGAMNLEELLLLEKHLEYWISHIRSAKMEIMLQEIQSLRNKEGVLKNANKYLLGKIEE 181 6799**************************************************************************99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF55455 | 4.71E-29 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.997 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 5.5E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.93E-40 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 1.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.9E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.489 | 95 | 185 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.0E-20 | 99 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEVGVVIFSP QGKLFELATK 60 GTMEGMIDKY MKCTGGGRGS SSAIFTAQEQ LQPPNLDPKD EVNVLKQEID MLQKGIRYMF 120 GGGEGAMNLE ELLLLEKHLE YWISHIRSAK MEIMLQEIQS LRNKEGVLKN ANKYLLGKIE 180 ETNNSILDAN FATVETNNYS YPLTMPSEIF QF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_A | 7e-16 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_B | 7e-16 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_C | 7e-16 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3mu6_D | 7e-16 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-15 | 3 | 70 | 2 | 68 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228190 | 0.0 | AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22. | |||
GenBank | BT006157 | 0.0 | BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds. | |||
GenBank | BT008332 | 0.0 | BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds. | |||
GenBank | BT008524 | 0.0 | BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006390757.1 | 1e-157 | hypothetical protein EUTSA_v10019132mg | ||||
Swissprot | Q38841 | 1e-137 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | V4KL99 | 1e-157 | V4KL99_EUTSA; Uncharacterized protein | ||||
STRING | AT1G71692.1 | 1e-134 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7052 | 26 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 1e-138 | AGAMOUS-like 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thhalv10019132m |
Entrez Gene | 18009224 |