PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019132m
Common NameEUTSA_v10019132mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 213aa    MW: 23977.8 Da    PI: 8.4462
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019132mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-26957149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     krien   rqvtf+kRr+g+lKKA+ELSvLCdaev v+ifs++gkl+e 
  Thhalv10019132m  9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEVGVVIFSPQGKLFEL 57
                     79********************************************996 PP

2K-box61.33.8e-219918118100
            K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      + e++ Lk+ei++Lq+ +R + G + + ++l+eL  Le++Le  +++iRs K+e++l++i+ l++ke  l+++nk+L  k+ee
  Thhalv10019132m  99 KDEVNVLKQEIDMLQKGIRYMFGGGEGAMNLEELLLLEKHLEYWISHIRSAKMEIMLQEIQSLRNKEGVLKNANKYLLGKIEE 181
                      6799**************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.71E-29176IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.997161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-37160IPR002100Transcription factor, MADS-box
CDDcd002652.93E-40278No hitNo description
PRINTSPR004041.3E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.48995185IPR002487Transcription factor, K-box
PfamPF014864.0E-2099179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEVGVVIFSP QGKLFELATK  60
GTMEGMIDKY MKCTGGGRGS SSAIFTAQEQ LQPPNLDPKD EVNVLKQEID MLQKGIRYMF  120
GGGEGAMNLE ELLLLEKHLE YWISHIRSAK MEIMLQEIQS LRNKEGVLKN ANKYLLGKIE  180
ETNNSILDAN FATVETNNYS YPLTMPSEIF QF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-15370268Myocyte-specific enhancer factor 2A
3kov_B1e-15370268Myocyte-specific enhancer factor 2A
3kov_I1e-15370268Myocyte-specific enhancer factor 2A
3kov_J1e-15370268Myocyte-specific enhancer factor 2A
3mu6_A7e-16370268Myocyte-specific enhancer factor 2A
3mu6_B7e-16370268Myocyte-specific enhancer factor 2A
3mu6_C7e-16370268Myocyte-specific enhancer factor 2A
3mu6_D7e-16370268Myocyte-specific enhancer factor 2A
3p57_A1e-15370268Myocyte-specific enhancer factor 2A
3p57_B1e-15370268Myocyte-specific enhancer factor 2A
3p57_C1e-15370268Myocyte-specific enhancer factor 2A
3p57_D1e-15370268Myocyte-specific enhancer factor 2A
3p57_I1e-15370268Myocyte-specific enhancer factor 2A
3p57_J1e-15370268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2281900.0AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22.
GenBankBT0061570.0BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds.
GenBankBT0083320.0BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds.
GenBankBT0085240.0BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390757.11e-157hypothetical protein EUTSA_v10019132mg
SwissprotQ388411e-137AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLV4KL991e-157V4KL99_EUTSA; Uncharacterized protein
STRINGAT1G71692.11e-134(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70522641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-138AGAMOUS-like 12